PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC02G28470.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NF-YB
Protein Properties Length: 262aa    MW: 28061.2 Da    PI: 6.8269
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC02G28470.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB172.44.8e-5436131297
            NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 
                      reqdr++Pianv+rim++vlPa+akis+daket+qecvse+isf+t+ea+++cqre+rkti+++d+lwa++ lGf+dyvepl++yl++yre+eg
  OPUNC02G28470.1  36 REQDRLMPIANVIRIMRRVLPAHAKISDDAKETIQECVSEYISFITGEANERCQREQRKTITAEDVLWAMSRLGFDDYVEPLSIYLHRYREFEG 129
                      89*******************************************************************************************9 PP

            NF-YB  96 ek 97 
                      e+
  OPUNC02G28470.1 130 ES 131
                      86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.103.9E-4934134IPR009072Histone-fold
SuperFamilySSF471131.55E-3838140IPR009072Histone-fold
PfamPF008084.1E-2542105IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.0E-166987No hitNo description
PROSITE patternPS0068507288IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.0E-1688106No hitNo description
PRINTSPR006151.0E-16107125No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0033613Molecular Functionactivating transcription factor binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 262 aa     Download sequence    Send to blast
MEAGYHPCAA NGAAADGNGG AQQAAAAAAA AAPAIREQDR LMPIANVIRI MRRVLPAHAK  60
ISDDAKETIQ ECVSEYISFI TGEANERCQR EQRKTITAED VLWAMSRLGF DDYVEPLSIY  120
LHRYREFEGE SRGVGVGVSA ARGDHHHHHH HGHVGGMLKS RAQGSMVTHH DMQMHAAMYG  180
GVVPPPPHPP PHHHAFQLMP PPHGQYAPYD MYGGDHGMAA YYGGMYAPGS GGNGDGSGSS  240
GSGGAGTPQT VNFEHQHPFG YK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g92_B8e-4035126192Transcription factor HapC (Eurofung)
4g91_B8e-4035126192Transcription factor HapC (Eurofung)
4csr_A8e-4034126294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4awl_B8e-4034126294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
1n1j_A9e-4034126193NF-YB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2880360.0AB288036.1 Oryza sativa Japonica Group OsHAP3E mRNA for HAP3 subunit of HAP complex, complete cds.
GenBankAK1078610.0AK107861.1 Oryza sativa Japonica Group cDNA clone:002-134-B07, full insert sequence.
GenBankAP0041790.0AP004179.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:OJ1124_G07.
GenBankAP0149580.0AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015624920.11e-114PREDICTED: nuclear transcription factor Y subunit B-10
SwissprotQ84W669e-65NFYB6_ARATH; Nuclear transcription factor Y subunit B-6
TrEMBLA0A0E0K4P50.0A0A0E0K4P5_ORYPU; Uncharacterized protein
STRINGBGIOSGA005701-PA1e-114(Oryza sativa Indica Group)
STRINGORGLA02G0264000.11e-114(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20138331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.22e-60nuclear factor Y, subunit B6